PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01559.1.g00240.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 110aa    MW: 12246.5 Da    PI: 10.617
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01559.1.g00240.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.21.4e-30959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  Zpz_sc01559.1.g00240.1.am.mk  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFAS 59
                                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.679161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-32323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-29361IPR002100Transcription factor, MADS-box
CDDcd002651.72E-39359No hitNo description
PfamPF003194.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFASA  60
RCDLPNPLLY PFAHARPLAG FICLRRGESH LGFVAASLLV TVSLNFCVVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-19374271Myocyte-specific enhancer factor 2A
3mu6_C6e-19374271Myocyte-specific enhancer factor 2A
3mu6_B6e-19374271Myocyte-specific enhancer factor 2A
3mu6_A6e-19374271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033282e-75AB003328.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:S11905.
GenBankAC0986952e-75AC098695.2 Oryza sativa Japonica Group chromosome 3 clone OJ1126B12, complete sequence.
GenBankAC2104752e-75AC210475.1 Oryza glaberrima clone OG_BBa0054O06, complete sequence.
GenBankAC2139152e-75AC213915.1 Oryza minuta clone OM__Ba0240A18, complete sequence.
GenBankAC2158142e-75AC215814.1 Oryza minuta clone OM__Ba0123B04, complete sequence.
GenBankAK0676412e-75AK067641.1 Oryza sativa Japonica Group cDNA clone:J013108C22, full insert sequence.
GenBankAK1049212e-75AK104921.1 Oryza sativa Japonica Group cDNA clone:001-047-H02, full insert sequence.
GenBankAP0149592e-75AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAY3324762e-75AY332476.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL20) mRNA, complete cds.
GenBankAY5519152e-75AY551915.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS210 mRNA, complete cds.
GenBankCT8291382e-75CT829138.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN046P14, full insert sequence.
GenBankCT8300372e-75CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence.
GenBankCU4063792e-75CU406379.1 Oryza rufipogon (W1943) cDNA clone: ORW1943S104H08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368741.13e-35hypothetical protein POPTR_0001s08510g
RefseqXP_006579437.11e-34PREDICTED: uncharacterized protein LOC100805260 isoform X1
RefseqXP_006579438.11e-34PREDICTED: uncharacterized protein LOC100805260 isoform X1
RefseqXP_016189938.11e-34PREDICTED: agamous-like MADS-box protein AGL19 isoform X1
SwissprotQ9XJ609e-36MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ6Q9I71e-35Q6Q9I7_ORYSJ; MADS-box protein RMADS210
STRINGLOC_Os03g03100.18e-35(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-35AGAMOUS-like 20